SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102315 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102315
Domain Number 1 Region: 11-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.2e-27
Family DEP domain 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000102315
Domain Number - Region: 115-158
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0288
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102315   Gene: ENSMUSG00000020599   Transcript: ENSMUST00000106704
Sequence length 232
Comment pep:known chromosome:GRCm38:11:109256002:109298106:-1 gene:ENSMUSG00000020599 transcript:ENSMUST00000106704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIRHQGQQYRPRMAFLQKIEALVKDMQNPETGVRMHNQRVLVTSVPHAMTGGDVLQWIT
QRLWISNLEAQNLGNFIVKYGYIYPLQDPKNLILKPDSSLYRFQTPYFWPTQQWPAEDTD
YAIYLAKRNIKKKGILEEYEKENYDFLNKKINYKWDFVIMQAKEQYRTGKERNKADRYAL
DCQEKAYWLVHRSPPGMNNVLDYGLDRVTNPNEVKVNQLSFSCVCTLTIVEQ
Download sequence
Identical sequences A2A6V9
ENSMUSP00000102315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]