SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102412 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102412
Domain Number 1 Region: 19-91
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000131
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102412   Gene: ENSMUSG00000020715   Transcript: ENSMUST00000106800
Sequence length 118
Comment pep:known chromosome:GRCm38:11:106434681:106487808:-1 gene:ENSMUSG00000020715 transcript:ENSMUST00000106800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARWLLLLLALLLPPPGPGSFGRTSTVTLPETLLFVSTLDGSLHAVSKRTGSIKWTLKE
DPVLQVPTHVEEPAFLPDPNDGSLYTLGGKNNEGLTVRIFSFLVYSEVLSQVLACFSM
Download sequence
Identical sequences B1ARJ5
ENSMUSP00000102412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]