SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102516 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102516
Domain Number 1 Region: 468-653
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.17e-45
Family cAMP-binding domain 0.00035
Further Details:      
 
Domain Number 2 Region: 251-464
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-33
Family Voltage-gated potassium channels 0.0023
Further Details:      
 
Domain Number 3 Region: 38-131
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.32e-19
Family Flavin-binding PAS domain 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102516   Gene: ENSMUSG00000001901   Transcript: ENSMUST00000106903
Sequence length 897
Comment pep:known chromosome:GRCm38:11:106008124:106034107:1 gene:ENSMUSG00000001901 transcript:ENSMUST00000106903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QRPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKSSSRSLTQRLLSHSFLGSEGSHSRPSGQGPGPGRGKYGTVSQ
IPQFTLSFVEFNLEKHRSGSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRGTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDDSQRGTCGYTCSPL
TVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACICS
LTSVGFGNVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVK
EFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCP
AFRGASKGCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGK
NDIFGEPASLHARPGKSSADVRALTYCDLHKIHRADLLEVLDMYPAFADTFWNKLEVTFN
LRDADGGLHSTPRQAPGNQDPQGFFLNDSQSGAAPSLSISDTSGLWPELLQQMPPSPPNP
REKLDCWPRELGFKLEQLQAQMNRLESRVSSDLSRILQLLQHPQGHPGYILGAPASSDLA
LFPETSVTQSSESMLLVGHLPSAQTLSYGDLDKHIRMPRNFSPRIPHVAAAMDKSLVPSS
EQEQPKGLLSPLASPLCPLEVQGLGGPHFSSLPEHLSSVPKQLEFQRHGSDPGFTRS
Download sequence
Identical sequences B1AR82
ENSMUSP00000102516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]