SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102639 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102639
Domain Number 1 Region: 673-866
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.51e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000405
Further Details:      
 
Domain Number 2 Region: 479-598
Classification Level Classification E-value
Superfamily PH domain-like 6.01e-18
Family Pleckstrin-homology domain (PH domain) 0.0067
Further Details:      
 
Domain Number 3 Region: 17-92
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000578
Family SH3-domain 0.0022
Further Details:      
 
Domain Number 4 Region: 242-279
Classification Level Classification E-value
Superfamily WW domain 0.000000015
Family WW domain 0.0026
Further Details:      
 
Domain Number 5 Region: 247-330,369-445
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000942
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102639   Gene: ENSMUSG00000034255   Transcript: ENSMUST00000107024
Sequence length 869
Comment pep:known chromosome:GRCm38:11:103331497:103360900:-1 gene:ENSMUSG00000034255 transcript:ENSMUST00000107024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADVEGDVYVLVEHPFEYTGKDGRRIAIQPNERYRLLRRSTEHWWHVRREPGGRPFYLP
AQYVRELPALGDPAPAPQPSVPQQRPAVPEPLAYDYRFVSTPVGADGSSAEPRGRASSLC
GPARQRTGGQRNSLAPGGPACLYVRPAAPVRPAQSLDDLARGGTAPPAGLLGSAGHFKAS
SVAGSWVCPRPLAPSDSENVYEAIPDLRCPPRAESPKQVDDPPEPVYANVERQPRATSPR
SAAAPPRLSPVWETHTDTGTGRPYYYNPDTGVTTWESPFETPEGTTSPATSRASVGSGES
LETEWGQYWDEESRRVFFYNPLTGETAWEDETEELEEDHQEQLEMQPSLSPRSPGQQRPP
TPETDYPELLASYPEEDYSPVGSFSDPGPASPLVAPPGWSCQITPDKQMLYTNQFTQEQW
VRLEDQHGKPYFYNPEDSSVQWELPQVPIPAPRSVRKSSQDSDTPAQASPPEEKIKTLDK
AGVLHRTKTVDKGKRLRKKHWSTSWTVLEGGVLTFFKDSKTSAAGGLRQPSKLSTPEYTV
ELKGASLSWAPKDKSSKKNVLELRSRDGSEYLIQHDSEAIISTWHKAIAEGISELSADLL
QGEEGEPSSADFGSSERLGSWREEDVRQNAASPSLSPGGLESDLSRVRHKLRKFLQRRPT
LQSLRDKGYIKDQVFGCALAQLCERERSPVPRFVQQCIRTVEARGLDIDGLYRISGNLAT
IQKLRYKVDHDERLDLDDGRWEDVHVITGALKLFFRELPEPLFPFSHFHQFIAAIKLQDP
AQRSRCVRDLVRTLPAPNQDTLRLLIQHLCRVIEHGEQNRMTVQNVAIVFGPTLLRPEME
EASMPMTMVFQNQVVELILHQCADIFPPH
Download sequence
Identical sequences A2AB59
ENSMUSP00000102639 NP_001192165.1.92730 10090.ENSMUSP00000102639 ENSMUSP00000102639 ENSMUSP00000039427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]