SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102710 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102710
Domain Number 1 Region: 3-159
Classification Level Classification E-value
Superfamily E set domains 9.1e-19
Family Arrestin/Vps26-like 0.029
Further Details:      
 
Domain Number 2 Region: 160-300
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000532
Family Arrestin/Vps26-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102710   Gene: ENSMUSG00000038393   Transcript: ENSMUST00000074519
Sequence length 397
Comment pep:known chromosome:GRCm38:3:96557957:96561883:1 gene:ENSMUSG00000038393 transcript:ENSMUST00000074519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGS
QQCKQTLDYLRYEDTLLLEEQPTAGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYG
CVDYWVKAFLDRPSQPTQEAKKNFEVMDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVS
VSARIDRKGFCEGDDISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVFTQKLSSVRG
NHIISGTCASWRGKSLRVQKIRPSILGCNILKVEYSLLIYVSVPGSKKVILDLPLVIGSR
SGLSSRTSSMASRTSSEMSWIDLNIPDTPEAPPCYMDIIPEDHRLESPTTPLLDDVDDSQ
DSPIFMYAPEFQFMPPPTYTEVDPCVLNNNNNNNNVQ
Download sequence
Identical sequences Q8BG60
ENSMUSP00000102710 ENSMUSP00000041467 NP_001009935.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]