SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102849 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102849
Domain Number 1 Region: 2002-2171
Classification Level Classification E-value
Superfamily C-type lectin-like 8.75e-31
Family C-type lectin domain 0.00067
Further Details:      
 
Domain Number 2 Region: 1739-1851
Classification Level Classification E-value
Superfamily CalX-like 2.22e-20
Family CalX-beta domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000102849
Domain Number - Region: 393-433
Classification Level Classification E-value
Superfamily Purple acid phosphatase, N-terminal domain 0.00615
Family Purple acid phosphatase, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102849   Gene: ENSMUSG00000059049   Transcript: ENSMUST00000107230
Sequence length 2172
Comment pep:known chromosome:GRCm38:4:82897927:83052339:-1 gene:ENSMUSG00000059049 transcript:ENSMUST00000107230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSPGCTGPKAQWFLLLQLLLLHLDRVSATFISINRGLRVMKGSSAFLSGDHLRVAVPKE
KDACRLEVVMNEPVTQRVGKLSPQVFDCHFLPNEVKYVHNGCPILDEDSVKLRLYRFTET
DTFMETFLLRVYLVEPDCNIIRMSSNVLEVTEFYGLSQAIDKNLLQFDYDRTASLDCTIR
LDPLRTQLPAHGKLVVVNRKSEGPRGDQPHSFFSETELGAGLKCPDGSCALELKQVASLK
VSCEEFLLTGFHYQHMQPPSPNIDYIPIQLDLTDRRSKTVYKSESAWLPVYIRVGIPNQV
PRAAFMAMFVLEVDQFILTPLTTSVLDCEEDETPKPLLVFNITKAPLQGYVTHLLDHTRP
ISSFTWKDLSDMQVAYQPPNSSHPERRHYTMELEVYDFFFERSAPITVHISIRTADTNAP
RVSWNTGLNLLEGQSRAITWEQFQIVDNDDIGAVQLVTIGGLQHGRLTVREGKGFLFTVT
DLQAGVVRYHHDDSDTTKDFVAFRIFDGHHSSHHKFPINILPKDDSPPFLITNVVIELEE
GKTILIQGSMLRASDMDSSDDYIFFNITKFPQAGEIMKKPGPRLIGYPVPGFLQRDLFSG
IIYYRHFGGEIFEDSFEFVLWDSHEPPNLSVPQVVTIHITPVDDQLPKEAPGISRHLVVK
ETEVAYITKKHLHFLDMESRDGELIYTVTRPPCFSFSHRHLDAGKLFMVDSIPKLTKNPT
APGLSSFTQHAVNHMKVAYMPPMQDIGPSPRHVQFTVSVSNQHGGALHGICFNITVLPVD
NQVPEVFTNTLRVVEGGQCTISTEHILVSDVDTPLDSISLSLKERPLHGGVELDGFPLNP
RGTFSWRDLNTLKVWYQHDGSEVLQDEIFLEVTDGTNSAAFVLHIEVFPVNDEPPILKAD
LIPMMHCSEGGEVTITPEYISATDADSDDLELLFLIAREPQHGVVRKAGLHVDRFSQGDV
ISGAVTYKHTGGEIGLEPCSDTVVLVVSDGEADPLMNGCCYDGPDSSVPLHKSFPTYQLN
ITVHPVDNQPPSIIIGRMLTVDEGFSAALTTHHLTVVDWDTAPDDLKFMLASQPQFGYLE
NALPSAGFEKSNIGIRIASFQWTDMKASHINYVQSRHLRVEPTADQFTVYATDGKHRSLE
TTFHVIINPTNDEAPDLAVQNITVYEGHMVELDSSIISATDRDIPKDPLLFSIALKPQHG
LLVDAAISKDSHQIKQLQHEIHSFSVDLLKNGMKLVYAHDDSESSADNFVIQLSDGKHKI
LKTISVNITPVNDETPTLSKKAEISMAVGDTRVLSSAVLSATDKDSPREKIHYVFERLPQ
NGQLQLKIGRDWVPLSTGMQCTQEDVDLNLLRYTHAGKTDSQDGDSFTFYLWDEDNRSPA
FDCHIIIEDMGKGDIVIHAKPLVVVKGDRGLLTTATLLAVDGADKPEELLYLITSPPRHG
QVEYVHSPGVPIASFSQMDIAGQTVCYIHKSRTAVPTDSFRFTISNGLQTQRGVFEITLQ
TVDSALPVLTKNKRLRLAEGAMGLLSADHLQLTDPDTPPENLTFFLAQLPRHGYLFLRGK
ALQHNFTQRDVDSGGVAYQHSGGGAREDYFTFLATDRKNQGFVVDGKVQKEPVRFTIQVD
QLDKAAPRITHLHSPTQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKILRGPLYGRL
ENTTTGEFIHERFSQKDLSHKTILYIINPSLQVTSDILEFQAMDPTGNTATPQSLDLRWS
YIEWAQTAYEVCENVGLLPLEVTRRGYPMDSAFVGVEVNQVSATVGKDFTVTPSKLLQFD
PGMSTKMWNIAITYDGLEEDDEVFEVILNSPVNAVLGTQTKAAVKILDSKGGRCHPSNSF
NQSKHSTWGKGPWHPLPSGSSSLTTSGSPLLERPPPSFTSGDALQGFGLTDLTQRKTMTQ
GNGKSVLPSSVCRNGTDTIYNYHGIVSLKLEGDRFSAHKRKAKISIVSQPQRTIKVAELP
LADKVESTTDLHFLRQGLRPLFPKNCSVDLKGLFHFEESTHRLYQCDGISWKAWSPQTKG
LEDRSCPGGWLLHSGYCHILVTRQKGTWTTATRACREQHQGDLVTVLSRRHMQWLWAMSG
RKPFWIGLKNQPRTGHWEWIGGEPVAFTNWRRGAPLHPKPGKNCALVQKRGQWQTKNCSK
GKAHNFVCSRKL
Download sequence
Identical sequences A2ADN1
NP_001185740.1.92730 XP_006538076.1.92730 XP_006538077.1.92730 XP_006538078.1.92730 XP_011248357.1.92730 ENSMUSP00000102849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]