SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102905 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102905
Domain Number 1 Region: 509-737
Classification Level Classification E-value
Superfamily SET domain 9.81e-62
Family Histone lysine methyltransferases 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000102905
Domain Number - Region: 433-472
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000274
Family Myb/SANT domain 0.022
Further Details:      
 
Domain Number - Region: 118-170
Classification Level Classification E-value
Superfamily CalX-like 0.017
Family CalX-beta domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102905   Gene: ENSMUSG00000006920   Transcript: ENSMUST00000107284
Sequence length 747
Comment pep:known chromosome:GRCm38:11:101191115:101226463:-1 gene:ENSMUSG00000006920 transcript:ENSMUST00000107284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIASPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEW
KKLRVQPVQPMKPVSGHPFLKKCTIESIFPGFDSQDMLMRSLNTVALVPIMYSWSPLQQN
FMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELV
DALNQYSDEEEDGHNDPSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAI
ASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLFCR
RCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGR
RRRRHPVVSASCSNASASAMAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASPAPA
QLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILK
LPTDELMNPAQKKKRKHRLWAAHCRKIQLKKDNNSTQVYNYQPCDHPDRPCDSTCPCIMT
QNFCEKFCQCSPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVV
SCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYD
KYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAG
EELFFDYRYSQADALKYVGIERETDVF
Download sequence
Identical sequences P70351
XP_006532241.1.92730 ENSMUSP00000102905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]