SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102906 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102906
Domain Number 1 Region: 512-740
Classification Level Classification E-value
Superfamily SET domain 9.81e-62
Family Histone lysine methyltransferases 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000102906
Domain Number - Region: 436-475
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000274
Family Myb/SANT domain 0.022
Further Details:      
 
Domain Number - Region: 121-173
Classification Level Classification E-value
Superfamily CalX-like 0.017
Family CalX-beta domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102906   Gene: ENSMUSG00000006920   Transcript: ENSMUST00000107285
Sequence length 750
Comment pep:known chromosome:GRCm38:11:101191116:101226450:-1 gene:ENSMUSG00000006920 transcript:ENSMUST00000107285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKMDIASPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILN
EEWKKLRVQPVQPMKPVSGHPFLKKCTIESIFPGFDSQDMLMRSLNTVALVPIMYSWSPL
QQNFMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFL
ELVDALNQYSDEEEDGHNDPSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIF
SAIASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTL
FCRRCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKC
SGRRRRRHPVVSASCSNASASAMAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASP
APAQLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESL
ILKLPTDELMNPAQKKKRKHRLWAAHCRKIQLKKDNNSTQVYNYQPCDHPDRPCDSTCPC
IMTQNFCEKFCQCSPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDC
KVVSCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGK
VYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAI
QAGEELFFDYRYSQADALKYVGIERETDVF
Download sequence
Identical sequences A0A0R4J1C0
NP_031996.1.92730 ENSMUSP00000102906 ENSMUSP00000102906 ENSMUSP00000102906 10090.ENSMUSP00000102906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]