SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102984 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102984
Domain Number 1 Region: 222-387,419-481
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-38
Family Voltage-gated potassium channels 0.0035
Further Details:      
 
Domain Number 2 Region: 484-678
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.63e-32
Family cAMP-binding domain 0.00071
Further Details:      
 
Domain Number 3 Region: 40-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.01e-24
Family Flavin-binding PAS domain 0.00014
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000102984
Domain Number - Region: 866-905
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0876
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102984   Gene: ENSMUSG00000035355   Transcript: ENSMUST00000107361
Sequence length 1018
Comment pep:known chromosome:GRCm38:11:100740376:100759740:-1 gene:ENSMUSG00000035355 transcript:ENSMUST00000107361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQGPRGFPIVYCSDGFCELTGYGRTEV
MQKTCSCRFLYGPETSEPALQRLQKALEGHQEHRTEICFYRKDGSAFWCLLDMMPIKNEM
GEVVLFLFSFKDISQSGGPGLGSPGIHGDNNHENSLGRRGTSSRLRSTKRQNRTVLHRLT
GHFGRRGQSSVKANSNLFEPKPSVPEYKVASVGGSRCLLLHYSIPKAVWDGLILLATFYV
AVTVPYNVCFAGDDDTPITSRHTLVSDIAVEMLFILDIILNFRTTYVSQSGQVISAPRSI
GLHYLATWFFVDLIAALPFDLLYVFNITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAV
VLTLLMSVFALLAHWMACVWYVIGRREMEANDPLLWDIGWLHELGKRLEEPYVNGSAGGP
SRRSAYIAALYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQR
MYSRRSLYHSRMKDLKDFIRVHRLPRPLKQRMLEYFQTTWAVNSGIDANELLRDFPDELR
ADIAMHLNREILQLPLFGAASRGCLRALSLHIKTSFCAPGEYLLRRGDALQAHYYVCSGS
LEVLRDNMVLAILGKGDLIGADIPELGQEPGSGAGPSCVLKTSADVKALTYCGLQQLSSR
GLAEVLRLYPEYAAAFRAGLPRDLTFNLRQGSENNGLGRFSRSPRLSQARSDTLGSSSDK
TLPSITETEGGTEPGAGSKPRRPHLLPNLSPARPRGSLVSLLGEELPPFSALVSSPSLSP
TPSPALAGRGQSPSPHGPPRGSAAWKPPQLLIPPLGTFGPPDLSPRIVDGIEDSSNTAEA
PTFRFSKRPEPTRTRSQAPPSGPRLSRELATEAAEEVKEKVCRLNQEISRLNQEVSQLSR
ELRQVMGLLQARLGPPSHTAGPAWLPDLPCPHQRLPCISPHMSGPPPGLQNTTLAVVHCP
ASVGTVEIGATPSELRPSTIPPYPSEPDPLGPSPAPEAPPLTPSLLKHSFQSGSDTFH
Download sequence
Identical sequences A2A5F7
ENSMUSP00000102984 ENSMUSP00000102984 ENSMUSP00000102986 10090.ENSMUSP00000102984 NP_001074663.1.92730 ENSMUSP00000102984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]