SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103445 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103445
Domain Number 1 Region: 29-486
Classification Level Classification E-value
Superfamily ALDH-like 6.68e-91
Family ALDH-like 0.00000296
Further Details:      
 
Domain Number 2 Region: 506-751
Classification Level Classification E-value
Superfamily ALDH-like 2.36e-39
Family ALDH-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103445   Gene: ENSMUSG00000007833   Transcript: ENSMUST00000107815
Sequence length 754
Comment pep:putative chromosome:GRCm38:7:45142445:45154584:-1 gene:ENSMUSG00000007833 transcript:ENSMUST00000107815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATRVQPSTREIFTTLEYGPVPESHACALAWLDTHNRLLGHHVNGMWLKPEHRNPAPCQ
DPITGENLASCLQAEAEDIAAAVEAAKIAFKAWSQLPGAARGQHLTRLAKVVQKHQRLLW
TLESLVTGRAVREVRDGDVPLAQQLLQYHAVQAHAQGDALADWQPVGVIGLILPTPFSFL
DMMWRVCPALAMGCTVVALVPPAFPTPLLLAQLAGELGSFPGILNVVCGPASLGPVLASQ
PGVQKVAFCGAVEEGRVLRRTLAGRGAELGLALGTESLLLLMDSADVDSAVEGVVDAVWS
DRSLGGLRLLIQESVWDEAMRRLQARMAQIRSGRGLDGAVDMGARGAAARDLAQSFVDEA
QSQGGQVFQAGDVPSSSPFFSPALVSGLPPAAPCAQAEVPWPVVMASPFRTVKEALALAN
GTPRGGSASVWSERLGQALELGYGLQVGTVWINAHGLRDPAVPTGGCKESGSSWHGGPDG
LYEYLQPLGTPSQESFLCENINYDTFGLAASSILPSGPETGPSPAPPYGLFVGGRFQSPG
TQSSRPIQDSSGKVSSYVAEGGAKDIRGAVEAAHQAAPGWGAQSPRARAGLLWALAAALE
RRKPVLTSQLERHGAAPTVAKIEVELSVRRLQTWGTRVQDQGQTLQVTGLRGPVLRLREP
LGVLAVVCPDEWPLLAFVSLLAPALAHGNAVVLVPSGACPLLALEVCQDIAPLFPAGLVS
VVTGDRDHLTRCLALHQDVQALWYFGSAQVLQGT
Download sequence
Identical sequences D3Z0B9
ENSMUSP00000103445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]