SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103490 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103490
Domain Number 1 Region: 46-275
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.44e-69
Family Carbonic anhydrase 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103490   Gene: ENSMUSG00000056158   Transcript: ENSMUST00000107858
Sequence length 304
Comment pep:known chromosome:GRCm38:11:93098414:93601273:1 gene:ENSMUSG00000056158 transcript:ENSMUST00000107858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLC
SVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVRGPMTYSHRLEEIRLHFGSEDSQGSE
HLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDT
ITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQM
HSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNE
WLLK
Download sequence
Identical sequences E9Q2V1
ENSMUSP00000103490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]