SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103815 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103815
Domain Number 1 Region: 10-132
Classification Level Classification E-value
Superfamily POZ domain 4.55e-29
Family BTB/POZ domain 0.00022
Further Details:      
 
Domain Number 2 Region: 606-668
Classification Level Classification E-value
Superfamily A DNA-binding domain in eukaryotic transcription factors 3.66e-22
Family A DNA-binding domain in eukaryotic transcription factors 0.0013
Further Details:      
 
Domain Number 3 Region: 654-701
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000323
Family Leucine zipper domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103815   Gene: ENSMUSG00000040270   Transcript: ENSMUST00000108180
Sequence length 839
Comment pep:known chromosome:GRCm38:4:32238804:32586104:1 gene:ENSMUSG00000040270 transcript:ENSMUST00000108180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVDEKPGSPMYVYESTVHCANILLGLNDQRKKDILCDVTLIVERKEFRAHRAVLAACSE
YFWQALVGQTKDDLVVSLPEEVTARGFGPLLQFAYTAKLLLSRENIREVIRCAEFLRMHN
LEDSCFSFLQTQLLNREDGLFVCRKDSACQRPQEDHGNSAGEEEEEEETMDSETARMACA
TDQMLPDPISFEATAIPVAEKEEALLPESEVPTDTKENSEKGALTQYPRYKKYQLACTKN
VYSAPSHGTSGFASTFSEDSPGNSLKPGLPMGQIKSEPPSEETEEESITLCLSGDETDIK
DRPGDVEMDRKQPSPAPTPSTPTGAACLDRSRSVSSPSCLRSLFGITKGVESTGLPSTSQ
QPLVRSSACPFNKGISQGDLKTDYTPLAGNYGQPHVGQKDVSNFAMGSPLRGPGPETLCK
QEGELDRRSVIFSASACDQPNTPVHSYSAVSNLDKDLSEPVPKSLWVGAGQSLPSSQAYS
HSGLMADHLPGRIRPNTSCPVPIKVCPRSPPLETRTRTSSSCSSYSYAEDGSGGSPCSLP
LCEFSSSPCSQGARFLATEHQEPGLMGDGMYNQVRPQIKCEQSYGTNSSDESGSFSEADS
ESCPVQDRGQEVKLPFPVDQITDLPRNDFQMMIKMHKLTSEQLEFIHDIRRRSKNRIAAQ
RCRKRKLDCIQNLECEIRKLVCEKEKLLSERNHLKACMGELLDNFSCLSQEVCRDIQSPE
QIQALHRYCPVLIPMDLPGASVNPPPVGVEQSLAPSPCAVGGSVPCCLEPGAAPPGLPWV
PSNTSENCTSGRRLEGSDPGTFSERGPPLEARSQSVTVDFCQEMTEKCTTDEQPRKDYA
Download sequence
Identical sequences P97303
ENSMUSP00000043693 10090.ENSMUSP00000103815 ENSMUSP00000103815 NP_001103131.1.92730 XP_006537630.1.92730 XP_011248211.1.92730 ENSMUSP00000103815 ENSMUSP00000131592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]