SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000104166 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000104166
Domain Number 1 Region: 72-128
Classification Level Classification E-value
Superfamily Kringle-like 3.71e-18
Family Fibronectin type II module 0.0034
Further Details:      
 
Domain Number 2 Region: 39-81
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000714
Family Fibronectin type II module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000104166   Gene: ENSMUSG00000078800   Transcript: ENSMUST00000108526
Sequence length 131
Comment pep:known chromosome:GRCm38:7:13554863:13571064:-1 gene:ENSMUSG00000078800 transcript:ENSMUST00000108526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVMSHLVHWVFLAVYMYELNAELISHLHPPEQEISTDSCVFPFVYADGFHYSCISLHSD
YDWCSLDFQFQGRWRYCTAQDPPKCIFPFQFKQKLIKKCTKEGYILNRSWCSLTENYNQD
GKWKQCSPNNF
Download sequence
Identical sequences Q0Q236
ENSMUSP00000104166 ENSMUSP00000104166 10090.ENSMUSP00000104166 NP_001074411.1.92730 ENSMUSP00000104166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]