SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000104356 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000104356
Domain Number 1 Region: 5-433
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-130
Family ALDH-like 0.00000000000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000104356   Gene: ENSMUSG00000019102   Transcript: ENSMUST00000108716
Sequence length 453
Comment pep:known chromosome:GRCm38:11:61208621:61218421:1 gene:ENSMUSG00000019102 transcript:ENSMUST00000108716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNISSIVNRARDAFNSGKTRPLQFRVEQLEALQRMINENLKGISKALASNLRKNEWTSY
YEEVAHVLDEIDFTIKGLSDWAEDEPVAKTRQTQEDDLYIHSEPLGVVLVIGAWNYPFNL
TIQPMVGAIAAGNAVVLKPSEVSDHMADLLSTLIPQYMDKDLYPVIKGGVPETTELLKEK
FDHIMYTGSTAVGKIVMAAAAKHLTPVTLELGGKSPCYVDKDCDLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQNEIVEKLKKSLKDFYGEDAKQSHDYGRIINDRHFQRVINLIDS
KKVAHGGTWDQPSRYIAPTILVDVDPQSPVMQEEIFGPVMPIVCVRSLDEAIKFINQREK
PLALYVFSNNDKVIKKMIAETSSGGVTANDVIVHITVPTLPFGGVGNSGMGAYHGKKSFE
TFSHRRSCLVRSLRNEEANKARYPPSPAKMPRH
Download sequence
Identical sequences P47739
ENSMUSP00000019246 10090.ENSMUSP00000104356 NP_001106196.1.92730 NP_031462.2.92730 XP_006532089.1.92730 XP_006532090.1.92730 ENSMUSP00000104356 ENSMUSP00000019246 ENSMUSP00000104356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]