SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000104875 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000104875
Domain Number 1 Region: 1053-1100
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 3.14e-17
Family Nuclear receptor coactivator interlocking domain 0.00012
Further Details:      
 
Domain Number 2 Region: 262-367
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.39e-16
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00097
Further Details:      
 
Domain Number 3 Region: 122-187
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000013
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.051
Further Details:      
 
Domain Number 4 Region: 35-92
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000829
Family HLH, helix-loop-helix DNA-binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000104875   Gene: ENSMUSG00000027678   Transcript: ENSMUST00000109252
Sequence length 1402
Comment pep:known chromosome:GRCm38:2:165992636:166071470:1 gene:ENSMUSG00000027678 transcript:ENSMUST00000109252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLGESSLDPLAAESRKRKLPCDAPGQGLVYSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKTISSDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYSILHEQDRKDFLKHLPKSTVN
GVSWTNENQRQKSHTFNCRMLMKTHDILEDVNASPETRQRYETMQCFALSQPRAMLEEGE
DLQCCMICVARRVTAPFPSSPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQR
FFSLNDGQSWSQKRHYQEAYVHGHAETPVYRFSLADGTIVSAQTKSKLFRNPVTNDRHGF
ISTHFLQREQNGYRPNPNPAGQGIRPPAAGCGVSMSPNQNVQMMGSRTYGVPDPSNTGQM
GGARYGASSSVASLTPGQSLQSPSSYQNSSYGLSMSSPPHGSPGLGPNQQNIMISPRNRG
SPKMASHQFSPAAGAHSPMGPSGNTGSHSFSSSSLSALQAISEGVGTSLLSTLSSPGPKL
DNSPNMNISQPSKVSGQDSKSPLGLYCEQNPVESSVCQSNSRDHPSEKESKESSGEVSET
PRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDPNCKDSSVSVTSPSGVSSSTSGTVS
STSNVHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTASCGEGTTRQEQLSP
KKKENNALLRYLLDRDDPSDVLAKELQPQADSGDSKLSQCSCSTNPSSGQEKDPKIKTET
NEEVSGDLDNLDAILGDLTSSDFYNNPTNGGHPGAKQQMFAGPSSLGLRSPQPVQSVRPP
YNRAVSLDSPVSVGSGPPVKNVSAFPGLPKQPILAGNPRMMDSQENYGANMGPNRNVPVN
PTSSPGDWGLANSRASRMEPLASSPLGRTGADYSATLPRPAMGGSVPTLPLRSNRLPGAR
PSLQQQQQQQQQQQQQQQQQQQQQQQQQQQQMLQMRTGEIPMGMGVNPYSPAVPSNQPGS
WPEGMLSMEQGPHGSQNRPLLRNSLDDLLGPPSNAEGQSDERALLDQLHTLLSNTDATGL
EEIDRALGIPELVNQGQALESKQDVFQGQEAAVMMDQKAALYGQTYPAQGPPLQGGFNLQ
GQSPSFNSMMGQISQQGSFPLQGMHPRAGLVRPRTNTPKQLRMQLQQRLQGQQFLNQSRQ
ALEMKMENPAGTAVMRPMMPQAFFNAQMAAQQKRELMSHHLQQQRMAMMMSQPQPQAFSP
PPNVTASPSMDGVLAGSAMPQAPPQQFPYPANYGMGQPPEPAFGRGSSPPSAMMSSRMGP
SQNAMVQHPQPTPMYQPSDMKGWPSGNLARNGSFPQQQFAPQGNPAAYNMVHMNSSGGHL
GQMAMTPMPMSGMPMGPDQKYC
Download sequence
Identical sequences A2A468
ENSMUSP00000104875 XP_006498951.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]