SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105023 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105023
Domain Number 1 Region: 6-34,74-135
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-22
Family Voltage-gated potassium channels 0.0039
Further Details:      
 
Domain Number 2 Region: 139-249
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.81e-21
Family Voltage-gated potassium channels 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105023   Gene: ENSMUSG00000035238   Transcript: ENSMUST00000109396
Sequence length 324
Comment pep:known chromosome:GRCm38:2:163853733:163859746:1 gene:ENSMUSG00000035238 transcript:ENSMUST00000109396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKQSARTAALILCILSYLLVGAAVFDALESEAERSRQRLLARKRGEFRRKYRFSADDYR
ELERLALQAEPHRAGRQWRFAGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPL
TLVTFQSLGERLNTLVRCLLLTAKRCLGLRRPHVSAENMVVAGLLLCAATLALGAIAFAH
FEGWTFFHAYYYCFITLTTIGFGDFVALQRDEALQRKPPYVAFSFLYILLGLTVIGAFLN
LVVLRFLASSDAPERAVHRRVSVFRRGAPESRVRAGASTCIPYPFHQLETWARDNPAFSP
PLSPEATHHCHSSPDRPRARRKSI
Download sequence
Identical sequences A2AHD2
ENSMUSP00000105023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]