SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105268 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105268
Domain Number 1 Region: 2-45
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000419
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105268   Gene: ENSMUSG00000021575   Transcript: ENSMUST00000109640
Sequence length 573
Comment pep:putative chromosome:GRCm38:13:74213237:74292297:-1 gene:ENSMUSG00000021575 transcript:ENSMUST00000109640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVFGQSPHADT
DNTVLGKLLRAQEGGKGLPSEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGKLKFLFGQK
KKTPSGTALPPRLSLFCIVAPVLPSVTEMKMKSTFLKAKHRADIVVTMDSRAKAVTSLCE
SELHPKLNYLAGKSNGENGISLFRGQTDRSHWARALARSSCLCLRGGPDLLDPKGTSGDR
EEEDQKHILRRSPGAWGQREMHKYSYGLETPVHLRHLNWSTEQRSQESTTKLTRQPSKNE
PSTCLVPHGSCVPYPGSQGMLSASNMASFRDSLDHPTGAYCSQMNRPLSDIHQGQVDPST
CHISQGSLGSRIPLTGMQRFTARGFSTEDAKLPSLPVTIGTPCNPVLSLDVPIKMENESG
SQDIVEASTTSCLWLGTSDMARGHLVGFPARMHLKTEPDYRQQACTPHLGHGMLGTNPYS
RDTVGSCREHAPLYSAHCTCLDPEPPHHFFMCSHSESQHPSLDQDCRAPIVKREPLDSPS
WAAPGQVTVPRMFPKSASKTVIPSKGSDGIFLP
Download sequence
Identical sequences A0A0R4J1D3
NP_001304280.1.92730 XP_006517111.1.92730 XP_006517112.1.92730 XP_006517113.1.92730 ENSMUSP00000105268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]