SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105483 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105483
Domain Number 1 Region: 201-643
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.61e-49
Family Quinoprotein alcohol dehydrogenase-like 0.015
Further Details:      
 
Domain Number 2 Region: 576-698,725-798
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 8.11e-23
Family Tricorn protease domain 2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105483   Gene: ENSMUSG00000058070   Transcript: ENSMUST00000109857
Sequence length 800
Comment pep:novel chromosome:GRCm38:12:108410662:108538392:1 gene:ENSMUSG00000058070 transcript:ENSMUST00000109857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVSDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPTKARPLGQTL
PLRTTVNNGTVLPKKPSASLPAPSGARKEVVVPVTKSINRTSSSERVSPGGRRESSGDSK
GSRNRTGSTSSSSSGKKNSESKPKEPAFSPALQSPKPQGKRRVTHCKEEGYVKMFLRGRP
VTMYMPKDQVDSYSLEAKAELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVV
LYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNT
LHVIGIGFFDRAVTCIAFSKSNGGGHLCAVDDSNDHVLSVWDWQKEERLADVKCSNEAVF
AADFHPTDTNIIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITG
DSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKLH
KAEIPEQFGPIRTVAEGKGNVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLAIHASK
PQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTET
KDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVTDNGRKYTRVGKCSGHSSFI
THLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPE
GSDGTDINAVCRAHERKLLCTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCE
DSHLISTGGKDTSIMQWRVI
Download sequence
Identical sequences D3Z4J9
NP_001273276.1.92730 XP_017170660.1.92730 ENSMUSP00000105483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]