SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105957 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105957
Domain Number 1 Region: 44-280
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.36e-63
Family Alanine racemase-like, N-terminal domain 0.000000136
Further Details:      
 
Domain Number 2 Region: 248-357
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.00000000000398
Family Eukaryotic ODC-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105957   Gene: ENSMUSG00000037458   Transcript: ENSMUST00000110328
Sequence length 357
Comment pep:novel chromosome:GRCm38:15:38489454:38519227:-1 gene:ENSMUSG00000037458 transcript:ENSMUST00000110328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQTVVA
QIKPFYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGVSPENIIFTSPCKQVSQI
KYAAKVGVNIMTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEDGNMKFGTTLKNCRHL
LECAKELDVQIIGVKFHVSSACKEYQVYVHALSDARCVFDMAGEFGFTMNMLDIGGGFTG
TEIQLEEVNHVISPLLDIYFPEGSGIQIISEPGSYYVSSAFTLAVNIIAKKVVENDKFSS
GVEKNGSDEPAFVYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFTSSLWGPS
Download sequence
Identical sequences ENSMUSP00000105957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]