SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105958 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105958
Domain Number 1 Region: 44-280
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.08e-63
Family Alanine racemase-like, N-terminal domain 0.000000114
Further Details:      
 
Domain Number 2 Region: 248-416
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.9e-33
Family Eukaryotic ODC-like 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105958   Gene: ENSMUSG00000037458   Transcript: ENSMUST00000110329
Sequence length 448
Comment pep:known chromosome:GRCm38:15:38488238:38519263:-1 gene:ENSMUSG00000037458 transcript:ENSMUST00000110329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQTVVA
QIKPFYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGVSPENIIFTSPCKQVSQI
KYAAKVGVNIMTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEDGNMKFGTTLKNCRHL
LECAKELDVQIIGVKFHVSSACKEYQVYVHALSDARCVFDMAGEFGFTMNMLDIGGGFTG
TEIQLEEVNHVISPLLDIYFPEGSGIQIISEPGSYYVSSAFTLAVNIIAKKVVENDKFSS
GVEKNGSDEPAFVYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFTSSLWGPSCDE
LDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYFMMSFSDWYEMQDAGI
TSDAMMKNFFFAPSCIQLSQEDSFSTEA
Download sequence
Identical sequences O35484
NP_001095928.1.92730 NP_061215.1.92730 ENSMUSP00000065544 10090.ENSMUSP00000105958 ENSMUSP00000065544 3btn_A 3btn_B ENSMUSP00000065544 ENSMUSP00000105958 W00007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]