SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106195 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106195
Domain Number 1 Region: 153-237
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 5.1e-21
Family Translation initiation factor IF3, C-terminal domain 0.0022
Further Details:      
 
Domain Number 2 Region: 76-145
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.00000000000235
Family Translation initiation factor IF3, N-terminal domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106195   Gene: ENSMUSG00000016510   Transcript: ENSMUST00000110566
Sequence length 276
Comment pep:known chromosome:GRCm38:5:146955367:146963797:-1 gene:ENSMUSG00000016510 transcript:ENSMUST00000110566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLLMRLMLQTTKLDHNLIGRCLQRHAVKPDPAQLSLSASTPKLLYLTSAKGFSTAGDP
QGERKQKRRDAFSNTGRKISERIIRVLDEKGMDLGMMHRADVIRLMNKQDLRLVQRNTSS
EPPEYQLMTGEQIHQERLKLREQEKAKPKTGPTMTKELVFSSNIGQHDLDTKSKQIQQWI
EKKYHVQVTIKRRKDAEQSEEETEEIFNQILQTMPDIATFSSRPKAIRGGTASMCVFRHL
SKKEEKAYRESQESQRRDTLSKDDDGNSKESDVVCQ
Download sequence
Identical sequences A4QMQ0 Q9CZD5
ENSMUSP00000016654 ENSMUSP00000016654 ENSMUSP00000016654 ENSMUSP00000063398 ENSMUSP00000106193 ENSMUSP00000106195 NP_001243029.1.92730 NP_001243030.1.92730 NP_001243031.1.92730 NP_083857.1.92730 XP_006504952.1.92730 10090.ENSMUSP00000106193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]