SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106896 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106896
Domain Number 1 Region: 114-217
Classification Level Classification E-value
Superfamily Tetraspanin 0.0000000000085
Family Tetraspanin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106896   Gene: ENSMUSG00000027217   Transcript: ENSMUST00000111265
Sequence length 248
Comment pep:known chromosome:GRCm38:2:93201760:93334487:-1 gene:ENSMUSG00000027217 transcript:ENSMUST00000111265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGDCLSCMKYLMFVFNFFVFLGGACLLGVGIWVLVDPTGFREIVATNPLLTTGAYIVLA
MGGLLFLLGFLGCCGAVRENRCLLLFFFLFILIIFLVELSAAILAFIFREHLTREFFTKE
LTKHYQGDNDTDVFSATWNSVMITFGCCGVNGPEDFKLASVFRLLTLDTEEVPKACCRRE
PQTRDGVVLSREECQLGRNPFINKQGCYTVILNTFETYVYLAGAFAIGVLAIELFLMVFA
MCLFRGIQ
Download sequence
Identical sequences Q80WR1
ENSMUSP00000028646 10090.ENSMUSP00000028646 ENSMUSP00000028646 ENSMUSP00000028646 ENSMUSP00000106896 NP_899003.1.92730 XP_006499537.1.92730 XP_006499538.1.92730 XP_006499539.1.92730 XP_006499540.1.92730 XP_011237827.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]