SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106967 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106967
Domain Number 1 Region: 332-614
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.7e-88
Family Eukaryotic proteases 0.00000000117
Further Details:      
 
Domain Number 2 Region: 102-197
Classification Level Classification E-value
Superfamily Kringle-like 1.86e-31
Family Kringle modules 0.0000147
Further Details:      
 
Domain Number 3 Region: 210-296
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-26
Family Kringle modules 0.0000415
Further Details:      
 
Domain Number 4 Region: 45-105
Classification Level Classification E-value
Superfamily GLA-domain 1.41e-19
Family GLA-domain 0.0000951
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106967   Gene: ENSMUSG00000027249   Transcript: ENSMUST00000111335
Sequence length 617
Comment pep:known chromosome:GRCm38:2:91625329:91636407:-1 gene:ENSMUSG00000027249 transcript:ENSMUST00000111335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHVRGLGLPGCLALAALVSLVHSQHVFLAPQQALSLLQRVRRANSGFLEELRKGNLERE
CVEEQCSYEEAFEALESPQDTDVFWAKYTVCDSVRKPRETFMDCLEGRCAMDLGVNYLGT
VNVTHTGIQCQLWRSRYPHKPEINSTTHPGADLKENFCRNPDSSTTGPWCYTTDPTVRRE
ECSVPVCQEGRTTVVMTPRSGGSKDNLSPPLGQCLTERGRLYQGNLAVTTLGSPCLPWNS
LPAKTLSKYQDFDPEVKLVENFCRNPDWDEEGAWCYVAGQPGDFEYCNLNYCEEAVGEEN
YDVDESIAGRTTDAEFHTFFNEKTFGLGEADCGLRPLFEKKSLKDTTEKELLDSYIDGRI
VEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPWDKNFTENDLLV
RIGKHSRTRYERNVEKISMLEKIYVHPRYNWRENLDRDIALLKLKKPVPFSDYIHPVCLP
DKQTVTSLLRAGYKGRVTGWGNLRETWTTNINEIQPSVLQVVNLPIVERPVCKASTRIRI
TDNMFCAGFKVNDTKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRKGKYGFYT
HVFRLKRWIQKVIDQFG
Download sequence
Identical sequences H7BX99
ENSMUSP00000106967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]