SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000107265 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000107265
Domain Number 1 Region: 309-399
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.94e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 46-116
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.37e-16
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 
Domain Number 3 Region: 132-227
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000433
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000107265   Gene: ENSMUSG00000040187   Transcript: ENSMUST00000111638
Sequence length 569
Comment pep:novel chromosome:GRCm38:6:146805530:146832646:1 gene:ENSMUSG00000040187 transcript:ENSMUST00000111638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPRKRRGRDSQPLQSEFMTDTTVESLPQNPFASLLSTRTGVSAPSGIREAHSQMEKRR
RDKMNHLIQKLSSMIPPHIPTAHKLDKLSVLRRAVQYLRSLRGMTELYLGENSKPSFIQD
KELSHLILKAAEGFLFVVGCERGRIFYVSKSVSKTLRYDQASLIGQNLFDFLHPKDVAKV
KEQLSCDGSPREKPIDTKTSQVYSHPYTGRPRMHSGSRRSFFFRMKSCTVPVKEEQPCSS
CSKKKDHRKFHTVHCTGYLRSWPLNVVGMEKESGGGKDSGPLTCLVAMGRLHPYIVPQKS
GKINVRPAEFITRFAMNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHSSLTDKHK
ADSYKFRVKDGAFVTLKSEWFSFTNPWTKELEYIVSVNTLVLGRSETRLSLLHCGGSSQS
SEDSFRQSCINVPGVSTGTVLGAGSIGTDIANEVLSLQRLHSSSPEDASPSEEVRDDCSV
NGGNAYGPASTREPFAVSPSETEVLEAARQHQSTEPAHPHGPLPGDSAQLGFDVLCDSDS
IDMAAFMNYLEAEGGLGDPGDFSDIQWAL
Download sequence
Identical sequences E9Q993
NP_001276608.1.92730 XP_006507117.1.92730 ENSMUSP00000107265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]