SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000107982 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000107982
Domain Number 1 Region: 194-697
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.06e-54
Family Quinoprotein alcohol dehydrogenase-like 0.021
Further Details:      
 
Domain Number 2 Region: 657-704,731-809
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000000118
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000107982   Gene: ENSMUSG00000032624   Transcript: ENSMUST00000112363
Sequence length 919
Comment pep:known chromosome:GRCm38:17:83350931:83480361:1 gene:ENSMUSG00000032624 transcript:ENSMUST00000112363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGFAGSLDDSISAASTSDVQDRLSALESRVQQQEDEITVLKAALADVLRRLAISEDHVA
SVKKSMPSKGQPSLREAISMSCITNGSGISRKQNHTSSVSIARKETLSSAAKSIKRPPTA
EKSHNSWENSDDSRNKLMKTVSTSKLISKVIKNADKHKDVIVNQEGEYIKMFMRGRPITM
FIPSDVDNYDDIRTELPPEKLKLEWVYGYRGKDCRANVYLLPTGEIVYFIASVVVLFNYE
ERTQRHYLGHTDCVRCLAVHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSVSLTTLHVIG
LGTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKSKIAEIKTTNEVVLAVEFH
PTDANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGDVLTGDSGGV
MLIWSKTMVEPPPGKGPKGVYQINRQIKAHDGSVFTLCQMRNGMLLTGGGKDRKIILWDH
DLNLEREIEVPDQYGTIRAVAEGRAEQFLVGTSRNFILRGTFNDGFQIEVQGHTDELWGL
ATHPFKDLLLTCAQDRQVCMWNSVEHRLEWTRLVDEPGHCADFHPSGTVVAIGTHSGRWF
VLDAETRDLVSIHTDGNEQLSVMRYSVDGTLLAVGSHDNFIYLYTVLENGRKYSRYGKCT
GHSSYITHLDWSPDNKHIMSNSGDYEILYWDIENGCKLIRNRSDCKDIDWTTYTCVLGFQ
VFGVWPEGSDGTDINALVRSHNRRVIAVADDFCKVHLFQYPCSKAKAPSHKYSAHSSHVT
NVSFTHNDSHLISTGGKDMSIIQWKLVEKLPVPQNEVITDASVTKTPASSSETARPSNSP
PLPPSLPLTGTAEEESRMGSSPTLVENSLEQIAEPSEEQSEWGSEDLGVVIDEEPASELS
ETQGATELPEEERGITPLC
Download sequence
Identical sequences A0A0R4J1G7
NP_001107834.1.92730 ENSMUSP00000107982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]