SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108264 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108264
Domain Number 1 Region: 351-696
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.03e-134
Family Transferrin 0.000000000332
Further Details:      
 
Domain Number 2 Region: 22-344
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.28e-121
Family Transferrin 0.000000000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108264   Gene: ENSMUSG00000032554   Transcript: ENSMUST00000112645
Sequence length 697
Comment pep:known chromosome:GRCm38:9:103204001:103230273:-1 gene:ENSMUSG00000032554 transcript:ENSMUST00000112645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHMKTVLPPDGPRLACVK
KTSYPDCIKAISASEADAMTLDGGWVYDAGLTPNNLKPVAAEFYGSVEHPQTYYYAVAVV
KKGTDFQLNQLEGKKSCHTGLGRSAGWVIPIGLLFCKLSEPRSPLEKAVSSFFSGSCVPC
ADPVAFPKLCQLCPGCGCSSTQPFFGYVGAFKCLKDGGGDVAFVKHTTIFEVLPEKADRD
QYELLCLDNTRKPVDQYEDCYLARIPSHAVVARKNNGKEDLIWEILKVAQEHFGKGKSKD
FQLFSSPLGKDLLFKDSAFGLLRVPPRMDYRLYLGHNYVTAIRNQQEGVCPEGSIDNSPV
KWCALSHLERTKCDEWSIISEGKIECESAETTEDCIEKIVNGEADAMTLDGGHAYIAGQC
GLVPVMAEYYESSNCAIPSQQGIFPKGYYAVAVVKASDTSITWNNLKGKKSCHTGVDRTA
GWNIPMGMLYNRINHCKFDEFFSQGCAPGYEKNSTLCDLCIGPLKCAPNNKEEYNGYTGA
FRCLVEKGDVAFVKHQTVLDNTEGKNPAEWAKNLKQEDFELLCPDGTRKPVKDFASCHLA
QAPNHVVVSRKEKAARVKAVLTSQETLFGGSDCTGNFCLFKSTTKDLLFRDDTKCFVKLP
EGTTPEKYLGAEYMQSVGNMRKCSTSRLLEACTFHKH
Download sequence
Identical sequences Q921I1
NP_598738.1.92730 ENSMUSP00000035158 10090.ENSMUSP00000108264 ENSMUSP00000035158 ENSMUSP00000035158 ENSMUSP00000108264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]