SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108294 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108294
Domain Number 1 Region: 13-126
Classification Level Classification E-value
Superfamily POZ domain 2.43e-26
Family BTB/POZ domain 0.00063
Further Details:      
 
Domain Number 2 Region: 314-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.98e-20
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 355-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.68e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 278-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000167
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108294   Gene: ENSMUSG00000049672   Transcript: ENSMUST00000112674
Sequence length 449
Comment pep:known chromosome:GRCm38:17:69383050:69390750:1 gene:ENSMUSG00000049672 transcript:ENSMUST00000112674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTY
FKKLFKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFL
DKLCSQKRDVSSPDESNGQSKSKYCLKLNRPIGDAADAQDDDVEEIGDQDDSPSDDTVEG
TPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALT
FNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHT
ADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERP
FACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTP
SAIQSETEQLQAAAMAAEAEQQLETIACS
Download sequence
Identical sequences F1LMU5 Q08376 Q544H8
ENSMUSP00000054897 10090.ENSMUSP00000108296 ENSMUSP00000054897 ENSMUSP00000054897 ENSMUSP00000108294 ENSMUSP00000108296 NP_033573.1.92730 NP_758828.2.100692 NP_758828.2.4139 XP_006524275.1.92730 XP_011244726.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]