SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108444 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108444
Domain Number 1 Region: 960-1209
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.81e-37
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 285-518
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.67e-35
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 3 Region: 662-795,835-913
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.88e-21
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 4 Region: 3-29,78-149
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000447
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000108444
Domain Number - Region: 1214-1361
Classification Level Classification E-value
Superfamily EF-hand 0.0162
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108444   Gene: ENSMUSG00000051331   Transcript: ENSMUST00000112825
Sequence length 1869
Comment pep:known chromosome:GRCm38:6:118592319:118757974:-1 gene:ENSMUSG00000051331 transcript:ENSMUST00000112825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIIDVPAEEDPSPCALETGHGR
QCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIY
FVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQA
EDIDPENEDEGMDEDKPRNRGAPAGLHDQKKGKFAWFSHSTETHVSMPTSETESVNTENV
AGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTL
TIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGG
ILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLF
LFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAY
GGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLA
RTASPEKKQEVMEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQPSENEDKSPHSN
PDTAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVND
TIFTNLILFFILLSSISLAAEDPVQHTSFRNHMTAYGAFLHKGSFCRNYFNILDLLVVSV
SLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLL
QFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFD
NVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMN
IFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNST
YFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYF
SDPWNVFDFLIVIGSIIDVILSETNSAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLL
WTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLF
RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL
FVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGF
GKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIK
KIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALS
LQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVTYY
QSDSRGNFPQTFATQRPLHINKTGNNQADTESPSHEKLVDSTFTPSSYSSTGSNANINNA
NNTALGRFPHPAGYSSTVSTVEGHGPPLSPAVRVQEAAWKLSSKRCHSRESQGATVNQEI
FPDETRSVRMSEEAEYCSEPSLLSTDMFSYQEDEHRQLTCPEEDKREIQPSPKRSFLRSA
SLGRRASFHLECLKRQKDQGGDISQKTALPLHLVHHQALAVAGLSPLLQRSHSPTTFPRP
CPTPPVTPGSRGRPLRPIPTLRLEGAESSEKLNSSFPSIHCSSWSEETTACSGSSSMARR
ARPVSLTVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMT
IEEMENAADNILSGGAQQSPNGTLLPFVNCRDPGQDRAVAPEDESCAYALGRGRSEEALA
DSRSYVSNL
Download sequence
Identical sequences ENSMUSP00000108444 NP_001277264.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]