SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000109257 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000109257
Domain Number 1 Region: 37-130
Classification Level Classification E-value
Superfamily FKBP-like 5.89e-29
Family FKBP immunophilin/proline isomerase 0.00000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000109257   Gene: ENSMUSG00000079480   Transcript: ENSMUST00000113627
Sequence length 131
Comment pep:known chromosome:GRCm38:X:102119447:102127669:1 gene:ENSMUSG00000079480 transcript:ENSMUST00000113627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKGKSGSGKGGKGGAASGSDSADKKSQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKS
GMRFSEVATQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKF
GYHIIMVEGRK
Download sequence
Identical sequences M0RCP9 Q9CWW6
ENSMUSP00000109257 10090.ENSMUSP00000072851 10090.ENSMUSP00000109257 ENSMUSP00000109257 NP_081457.1.92730 XP_003752117.1.100692 XP_003754822.1.4139 XP_011249230.1.92730 XP_021044206.1.100879 ENSMUSP00000109257 ENSRNOP00000067375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]