SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000109804 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000109804
Domain Number 1 Region: 1438-1577
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.26e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000212
Further Details:      
 
Domain Number 2 Region: 234-338
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000612
Family Calponin-homology domain, CH-domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000109804   Gene: ENSMUSG00000026933   Transcript: ENSMUST00000114167
Sequence length 1582
Comment pep:known chromosome:GRCm38:2:25926838:25983282:-1 gene:ENSMUSG00000026933 transcript:ENSMUST00000114167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDAGGRCAAEGWRRMEAPPEGADLVPLDRYDAARAKIAANLQWICAKAYGLDNIPEDLR
DPFYIDQYEQEHIKPPVIKLLLSSELYCRVCSLILKGDQVATLQGHQSVIQALSRKGIYV
MESDDTPVTDADLSQAPIKMSGHMAMVDALMMAYTVEMISIEKVVASVKRFSTFSASKEL
PYDLEDAMVFWINKVNLKMREITEKEVKLKQQPLESPAHQKVRYRREHLSARQSPYFPLL
EDLMRDGSDGAALLAVVHYYCPEQMKLDDICLKEVPSMADSLYNIRLLREFSNEHLNKCF
YLTLEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQPRDIQELKDAKTVLQQKSSRPP
VPISNATKRSFLGSPAAMSPADQPPSTQPLAEGSHRYHLHSEEPECLGKGASTFSPSHPL
LPLRQKQQKVSQTEEIPDQRHRSNSLTRVDGQPRGAIGAWPDKKNRPVSQPTSFALHHAA
SCDVDPSSGDSVSLARSISKDSLASNIIHLTPQNQPHPSAGKSNGKSLLSNVNIEDEDEE
LVAIIRTDVSPPSPQMPRTSPQAPGLVASIRSPQRQADTLESKPDSFYLEPLMPAVLRPA
KEKQITTKEDERGEGRPRTIMAKRPSEGSQPMVRKKVSGGHGSRDLNRTFTPIPCSEFAA
SIDLAEVGPQSAEATGEGQPLALGRFDTLPQGQAADGFFLHVGRAEEDEGRWYVGSQSPS
SHDSEPWTILRQDSDSDVVDVEDTEQDFIGEDHPVVIPRYAGEEESAKLQEDMKVKEHED
KDDASGRSSPCLSTTSQLSSMSMASGSVKMTSFAERKLQRLNSCETKSSTSSSQKTTPDA
SESCPAPLTTWRQKREQSPGRHSKDPASLLASELVQLHMQLEEKRRAIEAQKKKMEALSA
RQRLKLGKAAFLHVVKKGKADGAPQPLRPEHFTKEFTQHNGEDLDDGTCKTEGFLVKEEQ
RDLSDAQDVAFVQLHKPRDPAALHDGEKHRMISTALLEDSVGEVDVNECDLSIEKLNETI
STLQQAILKISQQQEQLLMKSPTVPTPGTKNNCQDQKIKAPVHFVEPLSPTGVPGHRKPP
RLGQGRNSRSGRPAELKVPKDRQQGCSRSKTPTPSVETLPQSRSLPPSTHPRSPSDPGGE
LPEKCLFDSYRLHDESNHRTFVLSSCKDANIVSEQVNFKEGLDTSVKEAGLSSSTITGKE
HTPVEEPLRSKASLIEVDLSDLKAPDEDGEVVGHESSVELGGDSDQKPGVGFFFKDEQKA
EDELAKKRAAFLLKQQRKAEEARARKQQLEAEVELKRDEARRKAEEDRLRKEEEKARREL
IKQEYLRRKQQQALEEQGLGKPKSKPKKPRPKSVHREESYSDSGTKCSSTHNLSQTHSGS
SLSLASAATTEPESVYSGGTPSHRVESLEALPILSRNPSRSTDRDWETASAASSLASVAE
YTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILEELEKCDANHYIILFRDAG
CQFRALYCYQPDTEEIYKLTGTGPKSITKKMIDKLYKYSSDRKQFNLIPAKTMSVSVDAL
TIHNHLWQPKRPTVPKKTQTRK
Download sequence
Identical sequences A0A0A0MQE5
NP_001263288.1.92730 ENSMUSP00000109804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]