SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000109860 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000109860
Domain Number 1 Region: 4-67
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.44e-22
Family Transducin (heterotrimeric G protein), gamma chain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000109860   Gene: ENSMUSG00000036402   Transcript: ENSMUST00000114222
Sequence length 72
Comment pep:known chromosome:GRCm38:6:66896549:67018146:1 gene:ENSMUSG00000036402 transcript:ENSMUST00000114222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKTASTNSIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLMGIPTSE
NPFKDKKTCIIL
Download sequence
Identical sequences Q9DAS9
ENSMUSP00000046557 ENSMUSP00000109860 ENSMUSP00000109862 ENSMUSP00000109863 ENSMUSP00000109864 ENSMUSP00000109865 ENSMUSP00000109866 10090.ENSMUSP00000109866 ENSMUSP00000046557 ENSMUSP00000046557 NP_001171027.1.92730 NP_001171028.1.92730 NP_001171029.1.92730 NP_001171030.1.92730 NP_001171031.1.92730 NP_079554.1.92730 XP_006505605.1.92730 XP_021044461.1.100879 XP_021044464.1.100879 XP_021044465.1.100879 XP_021044466.1.100879 XP_021508984.1.76796 XP_021508985.1.76796 XP_021508986.1.76796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]