SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000109956 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000109956
Domain Number 1 Region: 21-412
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.69e-56
Family L-arabinose binding protein-like 0.0042
Further Details:      
 
Domain Number 2 Region: 418-565,682-820
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.3e-55
Family Phosphate binding protein-like 0.0000000000947
Further Details:      
 
Domain Number 3 Region: 572-677,711-739
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000131
Family Voltage-gated potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000109956   Gene: ENSMUSG00000026959   Transcript: ENSMUST00000114317
Sequence length 906
Comment pep:known chromosome:GRCm38:2:25291181:25319095:-1 gene:ENSMUSG00000026959 transcript:ENSMUST00000114317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTMHLLTFALLFSCSFARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRAAQKRL
ETLLEERESKSKKRNYENLDQLSYDNKRGPKAEKVLQFDPGTKNVTALLMEARDLEARVI
ILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESA
HISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVE
FNEDGDRKFANYSIMNLQNRKLVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLK
IVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFC
VDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTI
NNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYL
LDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGF
AMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVEL
STMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFG
IGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFML
VAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQQYHPTDITGPLNLSDP
SVSTVV
Download sequence
Identical sequences A2AI16
NP_001171127.1.92730 ENSMUSP00000109956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]