SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000110750 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000110750
Domain Number 1 Region: 62-235,264-325
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.8e-45
Family Voltage-gated potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 329-514
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.37e-44
Family cAMP-binding domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000110750   Gene: ENSMUSG00000038319   Transcript: ENSMUST00000115098
Sequence length 820
Comment pep:known chromosome:GRCm38:5:24319589:24329591:-1 gene:ENSMUSG00000038319 transcript:ENSMUST00000115098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIPAGKESRTGALQPRAQKGRVRRAVRISSLVAQEVLSLGADVLPEYKLQAPRIHRWTI
LHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLKETEDGSQAPDCGYACQPLAVVDLIVD
IMFIVDILINFRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEEL
IGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMD
SHIGWLHNLGDQIGKPYNSSGLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIF
SICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEY
FQHAWSYTNGIDMNAVLKGFPECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKT
THAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNG
DVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSAELESG
FNRQRKRKLSFRRRTDKDTEQPGEVSALGQGPARVGPGPSCRGQPGGPWGESPSSGPSSP
ESSEDEGPGRSSSPLRLVPFSSPRPPGDPPGGEPLTEDGEKSDTCNPLSGAFSGVSNIFS
FWGDSRGRQYQELPRCPAPAPSLLNIPLSSPGRRSRGDVESRLDALQRQLNRLETRLSAD
MATVLQLLQRQMTLVPPAYSAVTTPGPGPTSASPLLPVGPVPTLTLDSLSQVSQFVAFEE
LPAGAPELPQDGPTRRLSLPGQLGALTSQPLHRHGSDPGS
Download sequence
Identical sequences A0A0R4J1K0
NP_001281091.1.92730 ENSMUSP00000110750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]