SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000110860 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000110860
Domain Number 1 Region: 450-524
Classification Level Classification E-value
Superfamily TGS-like 6.32e-26
Family G domain-linked domain 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000110860
Domain Number - Region: 247-341
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.00295
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000110860   Gene: ENSMUSG00000058440   Transcript: ENSMUST00000115206
Sequence length 534
Comment pep:novel chromosome:GRCm38:6:30048031:30144860:1 gene:ENSMUSG00000058440 transcript:ENSMUST00000115206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILN
STAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLD
EYTTRVGQQAIVLCISPSKPNPVFKVFGAAPLENVVRKYKSMILEDLESALAEHAPAPQE
VNSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPW
ANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQTQATTTHSIAHL
VPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNW
ATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLAE
ATLQGGGQIVLSGETAAAVGALTGVQDANGPDGVHAWTISKAVTAPQAAGKIHTDFGKGF
IMAEVMKDEDLKEESSENAAKAAGKYKQQGRAYVVEDGDIIFFKFNSPQQLKKK
Download sequence
Identical sequences Q99K73
ENSMUSP00000065568 ENSMUSP00000065568 ENSMUSP00000110860 NP_001157699.1.92730 XP_006505069.1.92730 XP_017176930.1.92730 XP_017176931.1.92730 XP_021045126.1.100879 10090.ENSMUSP00000065568 ENSMUSP00000067447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]