SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000110883 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000110883
Domain Number 1 Region: 956-1159
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000412
Family WD40-repeat 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000110883
Domain Number - Region: 510-563
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00144
Family RILP dimerisation region 0.0081
Further Details:      
 
Domain Number - Region: 40-176
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0067
Family BAR domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000110883   Gene: ENSMUSG00000024163   Transcript: ENSMUST00000115228
Sequence length 1322
Comment pep:known chromosome:GRCm38:17:24897533:24936894:-1 gene:ENSMUSG00000024163 transcript:ENSMUST00000115228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVV
NVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKK
ELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIE
RSKMQQVGGSGQTESSLPGRSRKERPTSLNVFPLADGMVRAQMGGKLVPAGDHWHLSDLG
QLQSSSSYQCPNDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLNESLQPLGDYV
SVTKNNKQAREKRNSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDVCPETRL
ERTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSGMGKEVGNLLL
ENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLENRIKELEEELKR
VKSEAVTARREPREEVEDDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEM
IRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRSYPSVNIHYKSPTAAGFSQRRSH
ALCQISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGRLQACGWSLPAKYKQ
LSPNGGQEDTRMKNVPVPVYCRPLVEKDPSTKLWCAAGVNLSGWKPHEEDSSNGPKPVPG
RDPLTCDREGEGEPKSTHPSPEKKKAKETPEADATSSRVWILTSTLTTSKVVIIDANQPG
TIVDQFTVCNAHVLCISSIPAASDSDYPPGEMFLDSDVNPEDSGADGVLAGITLVGCATR
CNVPRSNCSSRGDTPVLDKGQGDVATTANGKVNPSQSTEEATEATEVPDPGPSESEATTV
RPGPLTEHVFTDPAPTPSSSTQPASENGSESNGTIVQPQVEPSGELSTTTSSAAPTMWLG
AQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRGEDGQWDL
SNYHLMDLGHPHHSIRCMAVVNDRVWCGYKNKVHVIQPKTMQIEKSFDAHPRRESQVRQL
AWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLIAG
NRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGTRPGGIIHVYGDDSSDK
AASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPSEGPGPAAPAADA
EGQKLKNALVLSGGEGYIDFRIGDGEDDETEECAGDVNQTKPSLSKAERSHIIVWQVSYT
PE
Download sequence
Identical sequences ENSMUSP00000110883 NP_001156920.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]