SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000111390 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000111390
Domain Number 1 Region: 91-262,309-380
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-36
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1193-1440
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.12e-33
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 532-761
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.12e-30
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 873-1028,1068-1144
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.45e-29
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000111390
Domain Number - Region: 1448-1527
Classification Level Classification E-value
Superfamily EF-hand 0.00374
Family Polcalcin 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000111390   Gene: ENSMUSG00000031142   Transcript: ENSMUST00000115725
Sequence length 1977
Comment pep:novel chromosome:GRCm38:X:7607129:7635196:1 gene:ENSMUSG00000031142 transcript:ENSMUST00000115725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESEVGKDTTPEPSPANGTGPGPEWGLCPGPPTVGTDTSGASGLGTPRRRTQHNKHKTV
AVASAQRSPRALFCLTLTNPIRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPEDDS
NTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLL
EQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHI
ALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDMEAEEDPSPCASSGSGRSCTLNHTECR
GRWPGPNGGITNFDNFFFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGS
FFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQMEEDLRGYLDWITQAEELDLHDPS
VDGNLASLAEEGRAGHRPQLSELTNRRRGRLRWFSHSTRSTHSTSSHASLPASDTGSMTD
TPGDEDEEEGTMASCTRCLNKIMKTRICRHFRRANRGLRARCRRAVKSNACYWAVLLLVF
LNTLTIASEHHGQPLWLTQTQEYANKVLLCLFTVEMLLKLYGLGPSVYVASFFNRFDCFV
VCGGILETTLVEVGAMQPLGISVLRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLL
LLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILTGEDWNVVMYDG
IMAYGGPFFPGMLVCVYFIILFICGNYILLNVFLAIAVDNLASGDAGTAKDKGREKSSEG
NPPKENKVLVPGGENEDAKGARSEGAAPGMEEEEEEEEEEEEEEEEENGAGHVELLQEVV
PKEKVVPIPEGSAFFCLSQTNPLRKACHTLIHHHIFTSLILVFIILSSVSLAAEDPIRAH
SFRNHILGYFDYAFTSIFTVEILLKMTVFGAFLHRGSFCRSWFNLLDLLVVSVSLISFGI
HSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACI
GVQLFKGKFYSCTDEAKHTLKECKGSFLIYPDGDVSRPLVRERLWVNSDFNFDNVLSAMM
ALFTVSTFEGWPALLYKAIDANAEDEGPIYNYHVEISVFFIVYIIIIAFFMMNIFVGFVI
ITFRAQGEQEYQNCELDKNQRQCVEYALKAQPLRRYIPKNPHQYRVWATVNSAAFEYLMF
LLILLNTVALAMQHYEQTAPFNYAMDILNMVFTGLFTIEMVLKIIAFKPKHYFADAWNTF
DALIVVGSVVDIAVTEVNSSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSF
QALPYVALLIAMIFFIYAVIGMQMFGKVALQDGTQINRNNNFQTFPQAVLLLFRCATGEA
WQEIMLASLPGNRCDPESDFGPGEEFTCGSSFAIVYFISFFMLCAFLIINLFVAVIMDNF
DYLTRDWSILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGFGKLCPHRVA
CKRLVAMNVPLNSDGTVTFNATLFALVRTSLKIKTEGNLDQANQELRMVIKKIWKRIKQK
LLDEVIPPPDEEEVTVGKFYATFLIQDYFRKFRRRKEKGLLGREAPTSTSSALQAGLRSL
QDLGPEIRQALTYDTEEEEEEEEAVGQEAEEEEAENNPEPYKDSIDSQPQSRWNSRISVS
LPVKEKLPDSLSTGPSDDDGLAPNSRQPSVIQAGSQPHRRSSGVFMFTIPEEGSIQLKGT
QGQDNQNEEQEVPDWTPDLDEQAGTPSNPVLLPPHWSQQHVNGHHVPRRRLLPPTPAGRK
PSFTIQCLQRQGSCEDLPIPGTYHRGRTSGPSRAQGSWAAPPQKGRLLYAPLLLVEESTV
GEGYLGKLGGPLRTFTCLQVPGAHPNPSHRKRGSADSLVEAVLISEGLGLFAQDPRFVAL
AKQEIADACHLTLDEMDSAASDLLAQRTTSLYSDEESILSRFDEEDLGDEMACVHAL
Download sequence
Identical sequences B1AVA4
ENSMUSP00000111390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]