SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112011 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112011
Domain Number 1 Region: 42-295
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.71e-77
Family Crotonase-like 0.0000000893
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112011   Gene: ENSMUSG00000028601   Transcript: ENSMUST00000116309
Sequence length 296
Comment pep:known chromosome:GRCm38:4:108165466:108179307:1 gene:ENSMUSG00000028601 transcript:ENSMUST00000116309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRVLPRALRLPCSWRFSGARDCASHATTRTPEIQVQALTGPNQGITEILMNRPNARNAL
GNVFVSELLEALAQLREDQQVRVLLFRSAVKGVFCAGADLKEREQMSDVEVGTFVQRLRG
LMSEIAAFPVPTIAAMDGFALGGGLELALACDLRIAASSAVMGLIETTRGLLPGAGGTQR
LPRCLGVALAKELIFTGRRLNGAQARELGLVNHAVAQNEEGNAAYHRALALAQEILPQAP
IAVRLGKVAIDRGMEVDIASGMAIEQMCYAQNIPTQDRLEGMAAFREKRAPKFVGK
Download sequence
Identical sequences Q3TLP5
ENSMUSP00000051268 ENSMUSP00000112011 10090.ENSMUSP00000051268 ENSMUSP00000051268 NP_081004.2.92730 ENSMUSP00000051268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]