SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112447 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112447
Domain Number 1 Region: 103-292,335-497
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.93e-49
Family WD40-repeat 0.0029
Further Details:      
 
Domain Number 2 Region: 463-509,536-611
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000000785
Family Quinoprotein alcohol dehydrogenase-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112447   Gene: ENSMUSG00000040811   Transcript: ENSMUST00000120595
Sequence length 612
Comment pep:known chromosome:GRCm38:7:19181159:19206482:1 gene:ENSMUSG00000040811 transcript:ENSMUST00000120595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFGIGKTKEVIFSMEEGSVKMFLRGRPVPMLIPDELAPTYSLDTRSELPSSRLKLDWV
YGYRGRDCRANLYLLPTGEVVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAVHPDMVTI
ATGQVAGTTKEGKNGGNLLCAVDESNDHVLSVWDWAKESKVVDSKCSNEAVLVATFHPTD
PSLLITCGKSHIYFWSLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYV
WGKGGNRITQEVQGAHDGGVFALCALRDGTLVSGGGRDRRVVLWGSDYSKVQEVEVPEDF
GPVRTVAEGRGDTLYVGTTRNSILLGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQ
DKLVHLWSSETHQPVWSRSIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHT
DGNEQISVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQD
STCFVTNSGDYEILYWDPVTCKQITSADTVRNVEWATATCVLGFGVFGIWPEGADGTDIN
AVARSHDGKLLVSADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTG
GKDTSVLQWRVA
Download sequence
Identical sequences ENSMUSP00000112447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]