SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112765 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112765
Domain Number 1 Region: 65-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000977
Family EGF-type module 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112765   Gene: ENSMUSG00000082361   Transcript: ENSMUST00000121044
Sequence length 177
Comment pep:known chromosome:GRCm38:5:91357261:91402994:-1 gene:ENSMUSG00000082361 transcript:ENSMUST00000121044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPTAPGSSVSSLPLLLVLALGLAILHCVVADGNTTRTPETNGSLCGAPGENCTGTTPRQ
KVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFYLQQDRGQIL
VVCLIVVMVVFIILVIGVCTCCHPLRKHRKKKKEEKMETLDKDKTPISEDIQETNIA
Download sequence
Identical sequences Q05928 Q543J8
ENSMUSP00000112765 ENSMUSP00000112765 ENSMUSP00000112765 NP_031594.1.92730 10090.ENSMUSP00000112765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]