SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112791 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112791
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.57e-21
Family Ribosomal protein L39e 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112791   Gene: ENSMUSG00000039209   Transcript: ENSMUST00000121292
Sequence length 51
Comment pep:known chromosome:GRCm38:16:10170226:10174630:1 gene:ENSMUSG00000039209 transcript:ENSMUST00000121292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASHKTFRIKRFLAKKQKQNRPIPQWIQMKTGNKIMYNSKRRHWRRTKLGL
Download sequence
Identical sequences Q3ZB89 Q9CQD0
10090.ENSMUSP00000041794 10116.ENSRNOP00000040295 ENSMUSP00000041794 ENSRNOP00000040295 ENSMUSP00000041794 ENSMUSP00000112791 ENSRNOP00000040295 NP_001182400.1.100692 NP_001182400.1.4139 NP_080870.1.92730 XP_006522569.1.92730 XP_015857885.1.50099 XP_021045364.1.100879 XP_021065784.1.100879 XP_021504065.1.76796 ENSMUSP00000041794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]