SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112955 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112955
Domain Number 1 Region: 939-1142
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000403
Family WD40-repeat 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000112955
Domain Number - Region: 493-546
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00123
Family RILP dimerisation region 0.0081
Further Details:      
 
Domain Number - Region: 40-176
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00356
Family BAR domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112955   Gene: ENSMUSG00000024163   Transcript: ENSMUST00000119115
Sequence length 1305
Comment pep:known chromosome:GRCm38:17:24898799:24936960:-1 gene:ENSMUSG00000024163 transcript:ENSMUST00000119115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVV
NVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKK
ELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIE
RSKMQQVGGSGQTESSLPGRRKERPTSLNVFPLADGMCPNDEMSESGQSSAAATPSTTGT
KSNTPTSSVPSAAVTPLNESLQPLGDYVSVTKNNKQAREKRNSRNMEVQVTQEMRNVSIG
MGSSDEWSDVQDIIDSTPELDVCPETRLERTGSSPTQGIVNKAFGINTDSLYHELSTAGS
EVIGDVDEGADLLGEFSVRDDFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQL
SGEQEVLKGELEAAKQAKVKLENRIKELEEELKRVKSEAVTARREPREEVEDVSSYLCTE
LDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKKST
IWQFFSRLFSSSSSPPPAKRSYPSVNIHYKSPTAAGFSQRRSHALCQISAGSRPLEFFPD
DDCTSSARREQKREQYRQVREHVRNDDGRLQACGWSLPAKYKQLSPNGGQEDTRMKNVPV
PVYCRPLVEKDPSTKLWCAAGVNLSGWKPHEEDSSNGPKPVPGRDPLTCDREGEGEPKST
HPSPEKKKAKETPEADATSSRVWILTSTLTTSKVVIIDANQPGTIVDQFTVCNAHVLCIS
SIPAASDSDYPPGEMFLDSDVNPEDSGADGVLAGITLVGCATRCNVPRSNCSSRGDTPVL
DKGQGDVATTANGKVNPSQSTEEATEATEVPDPGPSESEATTVRPGPLTEHVFTDPAPTP
SSSTQPASENGSESNGTIVQPQVEPSGELSTTTSSAAPTMWLGAQNGWLYVHSAVANWKK
CLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRGEDGQWDLSNYHLMDLGHPHHSIRC
MAVVNDRVWCGYKNKVHVIQPKTMQIEKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTL
RLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLIAGNRLWVGTGNGVVISIPL
TETVVLHRGQLLGLRANKTSPTSGEGTRPGGIIHVYGDDSSDKAASSFIPYCSMAQAQLC
FHGHRDAVKFFVSVPGNVLATLNGSVLDSPSEGPGPAAPAADAEGQKLKNALVLSGGEGY
IDFRIGDGEDDETEECAGDVNQTKPSLSKAERSHIIVWQVSYTPE
Download sequence
Identical sequences ENSMUSP00000112955 NP_001156923.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]