SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113061 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113061
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 1.94e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113061   Gene: ENSMUSG00000033543   Transcript: ENSMUST00000119905
Sequence length 68
Comment pep:putative chromosome:GRCm38:9:70012565:70022737:1 gene:ENSMUSG00000033543 transcript:ENSMUST00000119905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRI
LARILRNE
Download sequence
Identical sequences D3Z7C2
NP_001269013.1.92730 ENSMUSP00000113061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]