SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113110 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113110
Domain Number 1 Region: 31-261
Classification Level Classification E-value
Superfamily Heme oxygenase-like 2.82e-73
Family Eukaryotic type heme oxygenase 0.00000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113110   Gene: ENSMUSG00000004070   Transcript: ENSMUST00000118885
Sequence length 315
Comment pep:known chromosome:GRCm38:16:4756903:4766245:1 gene:ENSMUSG00000004070 transcript:ENSMUST00000118885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEVETSEGVDESEKNSMAPEKENHTKMADLSELLKEGTKEAHDRAENTQFVKDFLKGN
IKKELFKLATTALYFTYSALEEEMDRNKDHPAFAPLYFPTELHRKAALIKDMKYFFGENW
EEQVKCSEAAQKYVDRIHYVGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTG
EGTQFYLFEHVDNAQQFKQFYRARMNALDLNLKTKERIVEEANKAFEYNMQIFSELDQAG
SMLARETLEDGLPVHDGKGDIRKCPFYAAQPDKGTLGGSNCPFQTTVAVLRKPSLQLILA
ASVALVAGLLAWYYM
Download sequence
Identical sequences O70252 Q544R7
NP_001129538.1.92730 NP_034573.2.92730 ENSMUSP00000004172 ENSMUSP00000112397 ENSMUSP00000113110 ENSMUSP00000004172 ENSMUSP00000112378 10090.ENSMUSP00000004172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]