SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113162 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113162
Domain Number 1 Region: 11-130
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.9e-25
Family Ankyrin repeat 0.00063
Further Details:      
 
Domain Number 2 Region: 279-325
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000844
Family LEM domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113162   Gene: ENSMUSG00000046295   Transcript: ENSMUST00000119976
Sequence length 534
Comment pep:novel chromosome:GRCm38:8:71406010:71409904:1 gene:ENSMUSG00000046295 transcript:ENSMUST00000119976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTACLALRLLAALREEEARAVEELLRLGADPNLVLDDGAAAVHLAARASHPRALHCLR
MLLRWGADPNARSAEGLTPVHVAAAWGCCGALELLLSRGGDPTLRDQDGLRPLDWALQQR
HHNCARVLQELDTPTQPDETREPTETFHVAQGSFETETCQGPALAESSGVSQDSELHVHR
AELEVEAVEVAVHPQSSEATENSDYSSDASFVTAVEDSLQPGRPGGALELVAGLWVTRGA
VSAGKGAPNCQPQVLTLTARDTDKPVLPGDGDLGALHPHSSVPPMSDLQLLQALRALGYS
PGPVTPFTRGHYLRRLQEAQASRADVGHSQELAEALRTGTIPDCQVDEEALAQCFQRLDP
LKKWREGITKSSFTYLLLDPRLTKDLPARASSLTLAECLQCFVRAIFYVGKGTRARPDAH
LWEAFGYHDQPRKQVCPKVRRILDIWASGRGIISLHCFQHVVAMEAYTREACLLDALGLQ
TLTNQKQGHYYGVVAHWPPSRRRRLGVHLLQRALLVFLAEGERELRPQDIQARG
Download sequence
Identical sequences A8VU90
ENSMUSP00000113162 NP_766344.2.92730 10090.ENSMUSP00000113162 ENSMUSP00000113162 ENSMUSP00000112797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]