SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113212 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113212
Domain Number 1 Region: 282-454
Classification Level Classification E-value
Superfamily vWA-like 1.18e-20
Family Integrin A (or I) domain 0.051
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000113212
Domain Number - Region: 700-779
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.00393
Family Terpene synthases 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113212   Gene: ENSMUSG00000038112   Transcript: ENSMUST00000119722
Sequence length 804
Comment pep:known chromosome:GRCm38:9:39587510:39603687:-1 gene:ENSMUSG00000038112 transcript:ENSMUST00000119722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRSGGLLTSIRDPVALKSIAVTLSINDFVAGVSATLNYENEEKSPLEAFFVFPMDEDSA
VYSFEAFVDGKKIVAELQDKYQAHKRYEEALSGGYQAYLLEEDKCSRDVFCCNVGNLQPG
SKVSLTLRYVQELPLEDDGALRYVLPAILNPRYHLSDGREDSNLDMKTPIVPLEELPYTL
SMVATISSQLGISTIQSNCPLNPIEYTGDNKTSAQVSLAEGHKFDRDVELLIFYRKVHSP
SVAVEMGMSGRPSDSLMGAPSAMVSFYPDIPEVETTTKCGEFVFLMDRSRSMNSPMSSKD
KSQLRIDAAKETLILLLKSLPMGCYFNIYGFGATHEEFFPDSVMYNQETMQIAVKKVKRL
LADLGGTELLTPLRKIFRKPPIPGHPLQVFVFTDGEVVETFSVIREVMFQSKKHRCFSFG
IGEGASTSLIKNLARVSGGTAEFITGNDRMQSKALRSLRRSLQSVVEDVSLSWNLPPKMF
APMLSPEQTSIFRGQRLIIYSLLIGKIPKEEATGEVCLSYKLHGKSYEEKVTFSLQPKPD
DNLTIHRLAAKSMIQSKDFGFKETSLMYKRDVLDISLESGVMSSFTAFVAINKELNEPIQ
GPLVHRDIPRPILLGAGPNRPSDGGYPKTLFCASAPVTLPPWLKGSGKCVATILMPNGTP
QQRQNSQKKKCVVHTDTRPELPHLAKYDSYPQGSKEHSIAQLIYLQNADGSWDMNEDLAK
ILSTSLEDITAACPTEVLEPSAWATMLAVIWLHANGKELKDEWELLERKAVVWLHNNSVR
GFNKLIRTANKLLKTSLSPSIFKL
Download sequence
Identical sequences Q8BGF0
ENSMUSP00000042582 ENSMUSP00000113212 NP_001186485.1.92730 NP_848852.1.92730 XP_006510367.1.92730 XP_017168863.1.92730 ENSMUSP00000042582 10090.ENSMUSP00000113212 ENSMUSP00000042582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]