SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113309 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113309
Domain Number 1 Region: 398-526,664-925
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.49e-36
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 
Domain Number 2 Region: 839-1081
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.56e-18
Family WD40-repeat 0.029
Further Details:      
 
Domain Number 3 Region: 1130-1242
Classification Level Classification E-value
Superfamily EF-hand 0.0000000281
Family Calmodulin-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113309   Gene: ENSMUSG00000029442   Transcript: ENSMUST00000121964
Sequence length 1299
Comment pep:novel chromosome:GRCm38:5:123252102:123327484:1 gene:ENSMUSG00000029442 transcript:ENSMUST00000121964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTEENPLEESRESGEMEEEKEEKKEEEEEEEEGEKEKEEEEEEEKGKEEEKEEEKEEG
KEEEKKEEEEEKGKKEEEEEEEEEGKGKEEEKEEEKEEEEKEEEKEKEEEEEEEGKGKEE
EEEGKEEEEEEKEEEEKEEEKEEEEEEEEEKEEYNPSFEEDALQQSLTEGSLSWEESQED
GEGLEEWVEKEEQREGEEVRGEEESEVRGREEEEGWEEEKSGEEEKSEESERSKERGGEE
EGQEKEEAEHEGEREEGREEEEKEKSVEREEEEEEEDTETTETKAGRAKEEKKEKQNKTA
LVDNIVISHEPPRSSSSLADSPEVSQIYKDNSMKVDDTEEASQKPEDILAQGKDEARLSL
EERRKLFQSKGLSAEESLVSVSTEDTLFQKEEDSKVYPLSMTWSFGWNSSLPVYYMREDR
RVILYTCAHTAIMYDVVRNTQYHLQGHPNIISCLCVSEDRRWIATADEGPDCLIIIWDSF
TGIPVHTIFDSCPEGNGMRSIAITRDSKFLATISDSATQKVCIWKWTLAVETPACTLELP
KEYGFQDNLVFNPANNKELVSNSKTQAIYYCWFEDKGILAHSAPVLTEKTFNKLVGKFSQ
SVFHLKLPQVLSATKEGKLVVWDIHYPSSTSSSAISAFPFIKPRKLVHLQKEAITVLMTI
DSYIVTGDIKGNIKFYDHTLSVVNWYSNFKLGAIRTLSFSKTIPSLPTEKSNLPTDCTLR
GDLFVVRNFIIGTFDATVYHMTVDGTKLEKLFVEPRDAVYAVSCHPYQPLIAVGSVCGMI
KVWDFEKKVYLFSRTFEKGLGVQCLTYNPEGALLGAGFTEGTVYILDAMSLENESPEPFK
YSKSSVSHCCFSHDSNYMATADVNFTVAVYMVVVKNGQRVWEYLARLRSHQNSIQSLLFG
VHLDSNEPRLLSLGKDRFLIEYNLVKSCKDHLDVLDVHRTDQGNYPTCMIWYPPLTKELF
LLICNSGYKVKLFNATTKMCRKTLLGPAYGSPIEHAQVLPVKSTLELQKRYLVFINKDKV
GLQILPVDGNPHKTCAIVCHPNGVAGMALSYDGRFAFTAGGQDRSVVQWKINLGALEAAV
SLGGEDLTPFYGLVSGGREGKFYRELEDYFYYSQIRSQGIDTMETRQVSEHICLSELPFV
MRAIGFYPSEEKIEDMFNEIKFSEYVETGKLIDKINLPDFLKVYLNHRPPFGNTMDGIQN
SFNVLGYTNSEGKKAIRREDFLNLLLTKGEHMTEEEMIDCFSTLFGLTPEGWKSEPAATC
INGPEICLQKELPEEITAEIFTTEILGLTLSDSSEQLIQ
Download sequence
Identical sequences E9Q743
ENSMUSP00000113309 10090.ENSMUSP00000113309 ENSMUSP00000069782 ENSMUSP00000113309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]