SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113369 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113369
Domain Number 1 Region: 30-324
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 7.98e-108
Family Inorganic pyrophosphatase 0.0000000674
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113369   Gene: ENSMUSG00000028013   Transcript: ENSMUST00000122334
Sequence length 329
Comment pep:novel chromosome:GRCm38:3:133310122:133378235:1 gene:ENSMUSG00000028013 transcript:ENSMUST00000122334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLPLLSVGRGWRVGAAARPPRRVMSLYRTEELGHPRSQDYRLFFKHVAGHYISPFHD
IPLKADCKEEHDIPRKKARNDEYENLFNMVVEIPRWTNAKMEIATEEPLNPIKQDIKNGK
LRYTPNIFPHKGYIWNYGALPQTWEDPHLRDKSTDCCGDNDPIDVCEIGSKVLSRGDVVH
VKILGTLALIDQSETDWKIIAINVNDPEAEKFHDIDDVKKFKPGYLEATLNWFRLYKVPD
GKPENKFAFNGEFKNKAFALDVINSAHERWKEMVMKKCDKGAISCVNVHICDSPFHCTME
EARSLVESVPTPSMNKESNVEEVWHFLRN
Download sequence
Identical sequences D3Z636
ENSMUSP00000113369 NP_001280570.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]