SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113400 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113400
Domain Number 1 Region: 25-291
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.45e-80
Family Carbonic anhydrase 0.00000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113400   Gene: ENSMUSG00000090236   Transcript: ENSMUST00000118960
Sequence length 324
Comment pep:known chromosome:GRCm38:16:17835276:17838364:-1 gene:ENSMUSG00000090236 transcript:ENSMUST00000118960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWALDFLLSFLLIQLAAQVDSSGTWCYDSQDPKCGPAHWKELAPACGGPTQSPINIDLRL
VQRDYTLKPFIFQGYDSAPQDPWVLENDGHTVLLRVNSCQQNCPAIRGAGLPSPEYRLLQ
LHFHWGSPGHQGSEHSLDEKHGSMEMHMVHMNTKYQSMEDARSQPDGFAILAVLLVEEDR
DNTNFSAIVSGLKNLSSPGVAVNLTSTFALASLLPSALRLLRYYRYSGSLTTPGCEPAVL
WTVFENTVPIGHAQVVQFQAVLQTGPPGLHPRPLTSNFRPQQPLGGRRISASPEASVRSS
VSTLPCLHLALVGLGVGLRLWQGP
Download sequence
Identical sequences Q99N23
ENSMUSP00000113400 ENSMUSP00000113400 NP_085035.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]