SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113446 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113446
Domain Number 1 Region: 98-189
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 3.92e-21
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000499
Further Details:      
 
Domain Number 2 Region: 45-96
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000227
Family TS-N domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113446   Gene: ENSMUSG00000040521   Transcript: ENSMUST00000120547
Sequence length 193
Comment pep:putative chromosome:GRCm38:10:127024235:127030799:-1 gene:ENSMUSG00000040521 transcript:ENSMUST00000120547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLRSLRFFPVACTGRSARAVLLQPSQPWLTFHAGPSLSSAASSKELLMKLRRKTGYSF
VNCKKALETCGGDLKQAEDWLHKQAQKEGWSKAAKLHGRKTKEGLIGLLQEGNTAVLVEV
NCETDFVSRNLKFQQLVQQVALGTMAHCQNLTDRLSTYSKGFLNSSELSELAAGPDREGS
LKDQLALAIGEYL
Download sequence
Identical sequences Q9CX33
ENSMUSP00000113446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]