SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113868 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113868
Domain Number 1 Region: 9-134
Classification Level Classification E-value
Superfamily DNA clamp 0.000000000000014
Family DNA polymerase processivity factor 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000113868
Domain Number - Region: 153-233
Classification Level Classification E-value
Superfamily DNA clamp 0.00408
Family DNA polymerase processivity factor 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113868   Gene: ENSMUSG00000038569   Transcript: ENSMUST00000117263
Sequence length 422
Comment pep:putative chromosome:GRCm38:5:122323223:122354232:-1 gene:ENSMUSG00000038569 transcript:ENSMUST00000117263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCGMTGGQVKVFGKAVQTLSRVSDELWLDPSEKGLALRSVNSCHSTYGYVLFSSMFFQ
HYQWSPFATMSDTDLPLNLNCKLAIKSVLPIFRCLNYLERSVEKCTVVARADKCRVVIQF
FGKHGIKRTHNVYFQDSQPLKIIFEKSLCANILMIKPRLLTEAIALLTSNQEEVTFSVTP
GNFCLKSLSGELLDLTSSVYSEMSFGPEEFDFFQVGLDTEITFCFKELKGILTFSEVMHA
PLAIYFDFPGKPVVLSVEDMLLEANFILATLVDYPSRTSSPQLLPLSQARRSHPIQSSAP
EDKSRVSQTPESISRAAPKRLFPKDSPDSSSAAETKRASAGQDDIFEVPESVVSDMEEER
SPSHLRKFSCMFFGAVSCEQQEYAGHPLDSLAVASDSEEDPSAALVPVRSAVGGRKHAVK
SV
Download sequence
Identical sequences 10090.ENSMUSP00000113868 ENSMUSP00000113868 ENSMUSP00000113868 ENSMUSP00000036177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]